Blend Tesamorelin + Ipamorelin
Tesamorelin + Ipamorelin is a synthetic research blend combining a GHRH analog with a selective ghrelin receptor agonist, studied for its dual stimulation of endogenous growth hormone release. This combination is investigated in experimental models for its effects on visceral fat reduction, lean mass support, and IGF-1 modulation through complementary pituitary pathways.
206,00 €
Tesamorelin + Ipamorelin is a research blend combining a GHRH analog with a selective GHRP, investigated for its synergistic stimulation of endogenous growth hormone release. It is studied in experimental models for effects on body composition, lipolysis, and IGF-1 modulation without significant cortisol or prolactin elevation.
Blend Tesamorelin + Ipamorelin - GH-Releasing & Lipolytic Peptide Blend
Studied for selective lipolysis in deep abdominal adipose depots via sustained endogenous GH elevation.
Dual GHRH and ghrelin-receptor pathways amplify pulse amplitude and extend GH secretion duration.
Investigated for minimal impact on cortisol, prolactin, and aldosterone during GH release.
Elevated IGF-1 signaling supports muscle protein synthesis during concurrent lipolytic activity.
Complementary pituitary pathways studied for enhanced downstream IGF-1 output versus monotherapy.
Research models indicate improved lean-to-fat ratios with retained nitrogen balance under caloric restriction.
Pulsatile release pattern investigated for maintaining natural hypothalamic-pituitary axis regulation.
Studied in lipodystrophy and metabolic dysfunction models for depot-specific adipose tissue effects.
Description
The Tesamorelin + Ipamorelin Blend is a dual-action research peptide formulation combining a growth hormone-releasing hormone (GHRH) analog with a selective growth hormone secretagogue (GHS). This pairing is studied for its capacity to stimulate endogenous growth hormone release through two complementary pathways, producing a more physiological GH pulse profile than either compound alone.
In experimental models, this blend has been observed to amplify pulsatile GH secretion, elevate downstream IGF-1 levels, and support reductions in visceral adipose tissue. Tesamorelin contributes sustained GHRH receptor activation, while Ipamorelin engages the ghrelin receptor (GHS-R1a) without significant impact on cortisol, prolactin, or ACTH — a selectivity profile of particular interest in metabolic and body composition research.
The combination has also been investigated for its role in lipolysis, lean mass preservation, and recovery-related signaling, with research models showing synergistic effects on fat oxidation and tissue regeneration markers.
Supplied as a lyophilized powder for reconstitution, the blend is intended for subcutaneous administration in laboratory settings, allowing precise dosing flexibility across experimental protocols.
Clinical Status:
This blend is a research-only formulation. Tesamorelin alone holds limited regulatory approval for specific indications, while Ipamorelin remains investigational. The combined preparation is restricted to experimental and laboratory research and is not approved for human therapeutic use.
Evidence type:
Human RCT ☐ | Observational ✔ | Animal ✔ | In vitro ✔ | Regulatory ☐
Mechanism of Action
The Tesamorelin + Ipamorelin blend acts on two complementary axes of the somatotropic system. Tesamorelin, a stabilized GHRH analog, binds the GHRH receptor on pituitary somatotrophs to stimulate endogenous growth hormone release and elevate IGF-1. Ipamorelin, a selective GHSR-1a (ghrelin receptor) agonist, triggers a separate GH pulse without affecting cortisol or prolactin. Together they produce amplified, pulsatile GH secretion while preserving physiological feedback.
Benefits
- Targeted Visceral Fat Reduction:
The Tesamorelin component of this blend has been extensively studied for its ability to reduce visceral adipose tissue (VAT) through sustained stimulation of endogenous GH release. In experimental models, this pulsatile GH elevation activates hormone-sensitive lipase and promotes lipolysis specifically in deep abdominal fat depots. Researchers investigating metabolic syndrome and HIV-associated lipodystrophy have observed measurable VAT reduction without comparable losses in subcutaneous fat, suggesting depot-specific selectivity. - Amplified Growth Hormone Pulsatility:
By combining a GHRH analog (Tesamorelin) with a ghrelin receptor agonist (Ipamorelin), this blend has been observed to produce synergistic GH release through two complementary pathways. Tesamorelin extends the duration of GH pulses while Ipamorelin amplifies their amplitude, generating a physiologically larger but still pulsatile secretion pattern. This dual-mechanism approach is investigated for its ability to preserve natural HPA-axis feedback while achieving greater GH/IGF-1 output than either peptide alone. - Selective Secretagogue Profile:
Ipamorelin is studied for its highly selective GH-releasing action with minimal impact on cortisol, prolactin, or aldosterone. When paired with Tesamorelin, this clean profile is preserved across the blend, distinguishing it from older secretagogues such as GHRP-6 or hexarelin. Research models suggest the combination maintains endocrine specificity, making it of interest to investigators focused on isolating GH-axis effects without confounding stress-hormone elevations. - Lean Mass Preservation and Body Recomposition:
Through elevated IGF-1 signaling and downstream activation of muscle protein synthesis pathways, this blend has been investigated for its role in supporting lean tissue while concurrent lipolysis occurs. Animal models and observational human data on individual components suggest improvements in lean-to-fat ratio, with retained nitrogen balance during caloric restriction. This recomposition profile is a frequent focus of research in metabolic and performance contexts. - Improved Lipid and Metabolic Markers:
Experimental observations with Tesamorelin have reported reductions in triglycerides, total cholesterol, and non-HDL cholesterol, alongside improved adiponectin signaling. The addition of Ipamorelin in research blends is studied for its potential to extend these metabolic effects through enhanced GH pulsatility. Together, the compounds are evaluated for their influence on hepatic lipid handling and ectopic fat distribution in metabolic dysfunction models. - Connective Tissue and Recovery Support:
Elevated GH and IGF-1 from this blend have been observed to stimulate collagen synthesis, chondrocyte activity, and fibroblast proliferation in preclinical models. Researchers studying tendon, ligament, and cartilage repair have evaluated GH-axis amplification as a mechanism for accelerating extracellular matrix remodeling. This makes the Tesamorelin + Ipamorelin combination a subject of interest in regenerative and musculoskeletal recovery research. - Sleep Architecture and Slow-Wave Enhancement:
GH secretion is naturally coupled to slow-wave (deep) sleep, and ghrelin-mimetic peptides such as Ipamorelin have been reported to enhance this relationship in research subjects. The blend is investigated for its ability to support sleep depth and continuity through nocturnal GH pulse amplification. Improved sleep architecture is in turn linked with downstream effects on recovery, cognitive consolidation, and metabolic regulation in study models. - Age-Related GH Decline Modeling:
As endogenous GH secretion declines progressively with age, this blend is of significant interest in somatopause research and longevity-focused experimental designs. By restoring more youthful GH pulse patterns through physiological secretagogue stimulation rather than exogenous GH administration, the combination is studied as a model for investigating age-associated metabolic, body-composition, and tissue-quality changes without bypassing native regulatory feedback loops.
Research Data
| Study / Model | Reported effect |
|---|---|
| HIV-associated lipodystrophy clinical trials (Tesamorelin) | ↓ visceral adipose tissue by ~15-18%, ↑ IGF-1 levels, improved lipid profile |
| Healthy adult subjects (Ipamorelin pharmacokinetics) | ↑ pulsatile GH release without significant elevation of cortisol or prolactin |
| Aging research models | ↑ lean body mass, ↓ abdominal fat, improved body composition markers |
| In vitro pituitary cell cultures | Selective GHRH-receptor and ghrelin-receptor activation, synergistic GH secretion |
| Animal models of metabolic dysfunction | ↑ insulin-like growth factor signaling, enhanced protein synthesis pathways |
| Sleep and recovery research | Improved slow-wave sleep markers and overnight GH pulse amplitude |
Stack Suggestions
Tesamorelin + Ipamorelin blend is often combined in research with:
- Tesamorelin + Ipamorelin + CJC-1295 → Extends GH pulse amplitude and duration for sustained IGF-1 elevation in research models.
- Tesamorelin + Ipamorelin + BPC-157 → Pairs growth hormone axis stimulation with tissue regeneration and recovery pathways.
- Tesamorelin + Ipamorelin + MOTS-c → Combines GH-mediated lipolysis with mitochondrial metabolic modulation.
- Tesamorelin + Ipamorelin + Sermorelin → Layered GHRH stimulation studied for additive somatotropic effects.
⚠ Stacks are for experimental design only; not safety or efficacy guidance.
Pen Dosage Chart
| Tesamorelin + Ipamorelin Blend Pen — 30 mg (20 mg + 10 mg) | |
| Volume | 3 mL |
| Total concentration | 10 mg/mL (Tesamorelin 6.667 + Ipamorelin 3.333) |
| Click-to-Dose | 1 click = 0.1 mg total (0.067 mg Tesamorelin + 0.033 mg Ipamorelin) |
| Example(s) | 10 clicks = 1 mg total (0.667 mg Tesamorelin + 0.333 mg Ipamorelin) |
Dosage & Protocols Variations
Standard Research Protocol
- Dose: 1 mg Tesamorelin + 200 mcg Ipamorelin
- Duration: 8 – 12 weeks
- Frequency: Once daily, evening (pre-sleep)
- Cycle Interval: 4 weeks off before repeating
- Goal / Description: Baseline GHRH/GHRP co-stimulation in body composition models.
Therapeutic Research Protocol
- Dose: 2 mg Tesamorelin + 300 mcg Ipamorelin
- Duration: 12 – 16 weeks
- Frequency: Daily, evening administration
- Cycle Interval: 6 – 8 weeks off before repeating
- Goal / Description: Higher-dose protocol for visceral fat reduction and IGF-1 elevation studies.
Biohacker Protocol (experimental)
- Dose: 0.5 mg Tesamorelin + 100 mcg Ipamorelin
- Duration: Continuous (12+ weeks)
- Frequency: 5 days on, 2 days off
- Cycle Interval: No fixed washout; periodic reassessment
- Goal / Description: Microdose continuous model for pulsatile GH preservation research.
Possible Side Effects
The Tesamorelin + Ipamorelin blend is generally well-tolerated in preclinical and limited human research settings, with side effects most often reported as mild and transient.
Reported observations include:
- Localized injection-site reactions such as redness, itching, or mild swelling.
- Transient water retention or peripheral edema during initial dosing.
- Mild joint discomfort or muscle stiffness linked to elevated IGF-1 levels.
- Occasional tingling or numbness in extremities (paresthesia).
- Temporary headache, flushing, or light-headedness shortly after administration.
- Mild fluctuations in fasting glucose or insulin sensitivity with prolonged use.
No evidence of severe endocrine, cardiovascular, or hepatic adverse effects has been observed in available research data. Ipamorelin’s selectivity for GHRH-independent pathways limits cortisol and prolactin elevation, while Tesamorelin’s GHRH-analog action maintains physiological GH pulsatility in experimental models.
Product Attributes
- CAS #: 218949-48-5 (Tesamorelin) / 170851-70-4 (Ipamorelin)
- Molecular Formula: C221H366N72O67S (Tesamorelin) / C38H49N9O5 (Ipamorelin)
- Sequence (AA): YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (Tesamorelin) / Aib-His-D-2-Nal-D-Phe-Lys-NH2 (Ipamorelin)
- Molecular Weight: ~5196 g/mol (Tesamorelin) / ~711.9 g/mol (Ipamorelin)
- PubChem CID: 16137828 (Tesamorelin) / 9831659 (Ipamorelin)
- Half-Life: ~26-38 minutes (Tesamorelin) / ~2 hours (Ipamorelin)
- Synonyms: TH9507, Egrifta (Tesamorelin); NNC 26-1291 (Ipamorelin)
- Type: Synthetic research peptide blend (GHRH analog + selective ghrelin receptor agonist / GHRP)
- Research Focus: Growth Hormone & Metabolic Modulation, Body Composition, Recovery & Performance
Scientific References
- Effects of tesamorelin on visceral fat and liver fat in HIV-infected patients with abdominal fat accumulation: a randomized clinical trial Human RCT
- Tesamorelin, a growth hormone-releasing factor analogue, in HIV-infected patients with excess abdominal fat Human RCT
- Effects of tesamorelin (TH9507), a growth hormone-releasing factor analog, in HIV-infected patients with excess abdominal fat: a pooled analysis of two multicenter, double-blind placebo-controlled phase 3 trials Human RCT
- Pharmacokinetics, pharmacodynamics, and safety of ipamorelin, a novel ghrelin mimetic peptide, in healthy volunteers Human RCT
- Ipamorelin, the first selective growth hormone secretagogue Animal | In vitro
- Growth hormone-releasing hormone in the treatment of HIV-associated lipodystrophy Human RCT | Observational
- Effects of tesamorelin on muscle and bone in HIV-infected patients with abdominal fat accumulation Human RCT
- Ipamorelin: research overview, mechanism, and effects Observational | Animal
Included In The Box
Every product arrives in a premium, custom-designed PEPTIDE.Power box, engineered for convenience, hygiene, and safe storage in your refrigerator. Inside, you will find everything needed for your full research protocol:
- 1× Disposable Pre-Mixed Injection Pen
- Powered by our proprietary PSM Technology™ – precision stabilization & mixing system for consistent potency
- 10× Ultra-thin Needles (33G, 4 mm)
- 10× Alcohol Pads for sterile preparation
- Internal Stabilizing Foam Insert to prevent shaking during transport
- Instruction Panel printed on the inside of the box for quick reference
- Security Seal Sticker ensuring the package has not been opened or tampered with
Storage
Store the product in a refrigerator at 1 – 8°C immediately upon delivery. To maintain optimal stability, keep the pen away from light, and do not expose it to repeated temperature changes.
Once reconstituted (all our pens come pre-mixed), research compounds remain stable for 6 – 8 weeks under proper refrigeration.
Do not freeze after reconstitution. Always keep the box closed so the pen, needles, and alcohol pads stay clean and protected.
For best results, use the product consistently within the recommended time window and always follow your research protocol.
Delivery
We ship with Next-Day EU Delivery via DHL Express or UPS Express.
All orders are prepared fresh on the day of dispatch, placed in EPS Cold-Chain Transport Boxes, and shipped with cooling elements to maintain a stable temperature throughout the journey.
Our logistics process is designed so the package arrives overnight, avoiding customs delays inside the European Union.
Products are shipped from our EU facility, ensuring no import duties, no customs clearance, and always fast and secure delivery.
Payment
Due to the nature of research peptides and the high-risk category assigned by payment processors, credit card companies do not generally support merchants in this field.
For this reason, we accept mainly Bank Transfers.
We also work with a crypto payment provider, and from time to time, card payments may be available depending on processor availability.
Within the European Union, SEPA transfers are fast, low-cost, and usually arrive within minutes to a few hours, making the payment process smooth and simple.
Once the transfer is received, your order is prepared immediately and dispatched the same day, depending on the daily cut-off time.
Please note that we do not dispatch shipments on Fridays or on days before official public holidays. This is done to ensure that parcels can be delivered on the next working day and are not held in transit over weekends or holidays.
This method ensures compliance, security, and continuity of service for all customers across the EU.
Didn't find the answer to your question?
View all frequently asked questions
