GLP-1S

S​еmаglutіdе is a synthetic GLP-1 receptor agonist, a key incretin hormone that regulates glucose metabolism and appetite. Developed for research use in metabolic and weight regulation studies. It mimics the action of the natural incretin hormone GLP-1, enhancing insulin secretion and reducing appetite in research models.

109,00 

Quality Certificates

Independent third-party lab analysis (CoA) - from our own in-house brand.

GLP-1S - Weight Management & Glucose Control

Weight Management

Supports body weight regulation through appetite and energy control

Glucose Regulation

Enhances insulin sensitivity and glucose stability

Cardiometabolic Support

Studied for improving lipid and cardiovascular parameters

Slowed Gastric Emptying

Reduces food intake by delaying digestion

Appetite Suppression

Acts on hypothalamic centers regulating hunger

Hormonal Modulation

Mimics incretin pathways via GLP-1 receptor activation

Long-Acting Profile

Once-weekly SubQ dosing for consistent research exposure

Improved Metabolic Efficiency

Optimizes energy expenditure and body composition

Description

S​еmаglutіdе is a long-acting GLP-1 receptor agonist studied for its ability to improve glycemic control, promote weight loss, and enhance metabolic efficiency. It mimics endogenous glucagon-like peptide-1 to stimulate insulin secretion, suppress glucagon release, and delay gastric emptying, providing sustained metabolic regulation.

In clinical research, S​еmаglutіdе has demonstrated significant body weight reduction and improved lipid profiles through appetite suppression, increased energy expenditure, and enhanced insulin sensitivity. These effects make it one of the most widely studied peptides in obesity and metabolic health research.

S​еmаglutіdе also contributes to cardiometabolic protection by improving endothelial function, reducing inflammation, and lowering blood pressure and triglycerides. Its neuroendocrine effects extend to appetite regulation centers in the hypothalamus, contributing to long-term behavioral changes in caloric intake and energy balance.

Formulated in a stabilized pre-mixed injection pen for SubQ administration, S​еmаglutіdе ensures high systemic bioavailability and precise dosing control under experimental conditions. It is an essential research peptide for studies focused on obesity, diabetes, and energy metabolism.

Clinical Status:
S​еmаglutіdе is a synthetic peptide analog approved for type 2 diabetes and obesity management but also widely studied in research for expanded metabolic and longevity applications.

Evidence type:
Human RCT ✔ | Observational ✔ | Animal ✔ | In vitro ✔ | Regulatory ✔

Mechanism of Action​

S​еmаglutіdе is a GLP-1 receptor agonist that activates cyclic AMP pathways in pancreatic β-cells, enhancing glucose-dependent insulin secretion while suppressing glucagon release. Peripheral and central GLP-1R activation contributes to appetite suppression through hypothalamic proopiomelanocortin (POMC) neuron stimulation. The substitution of alanine with α-aminoisobutyric acid and acylation with a C18 fatty acid chain increases albumin binding and resistance to DPP-4 degradation, extending its half-life to approximately one week. These structural modifications allow for sustained plasma levels and effective weekly dosing in metabolic research.

Benefits

  • Potent GLP-1 Receptor Agonist for Metabolic Regulation:
    S​еmаglutіdе is a synthetic GLP-1 receptor agonist extensively studied for its ability to enhance insulin secretion, suppress glucagon release, and delay gastric emptying. These combined actions improve glycemic control and support energy balance, making it one of the most effective peptides under investigation for obesity and type 2 diabetes research.
  • Significant Weight Reduction in Long-Term Studies:
    Human clinical trials demonstrate that S​еmаglutіdе produces average weight reductions of 12-16% through appetite suppression, improved insulin sensitivity, and enhanced fat metabolism. This sustained fat loss effect positions S​еmаglutіdе as a leading peptide in experimental weight management and body recomposition models.
  • Improved Glycemic Control and Insulin Sensitivity:
    S​еmаglutіdе enhances glucose-dependent insulin secretion and improves pancreatic beta-cell function. It reduces HbA1c and fasting glucose levels without causing hypoglycemia, providing a balanced metabolic profile ideal for studies focusing on glucose tolerance, insulin resistance, and diabetic metabolism.
  • Reduction of Visceral Fat and Lipid Optimization:
    Clinical and preclinical research show that S​еmаglutіdе reduces visceral and hepatic fat accumulation by modulating lipid oxidation and suppressing hepatic lipogenesis. These effects contribute to improved liver enzyme levels, lipid profiles, and overall cardiovascular health, making it valuable in metabolic and hepatic research applications.
  • Regulation of Appetite and Caloric Intake:
    Through its action on hypothalamic satiety centers, S​еmаglutіdе reduces appetite and food cravings while prolonging post-meal fullness. This appetite-regulating mechanism supports sustained caloric reduction and forms the foundation of its effectiveness in weight management and obesity research models.
  • Cardiometabolic Protection and Vascular Health:
    Studies reveal that S​еmаglutіdе lowers LDL cholesterol, triglycerides, and systolic blood pressure while improving endothelial function. These effects provide strong evidence of cardioprotective potential, making it a promising candidate in research on cardiovascular and metabolic health synergy.
  • Reduction of Inflammatory and Oxidative Stress Markers:
    S​еmаglutіdе administration has been associated with decreased levels of CRP, TNF-α, and IL-6, reflecting a reduction in systemic inflammation. It also improves oxidative balance by upregulating antioxidant defenses, contributing to cellular protection in metabolic stress models.
  • Preservation of Lean Muscle During Fat Loss:
    Unlike extreme caloric restriction or pharmacological weight-loss methods, S​еmаglutіdе selectively reduces adipose tissue while preserving lean muscle mass. This supports long-term metabolic stability and aligns with research targeting body recomposition and muscle retention during fat reduction.
  • Improvement of Liver Health and NAFLD Parameters:
    In models of non-alcoholic fatty liver disease (NAFLD), S​еmаglutіdе has demonstrated a reduction in hepatic steatosis, inflammation, and fibrosis. These outcomes are linked to improved lipid metabolism, mitochondrial function, and insulin signaling, emphasizing its potential in hepatic and metabolic disorder research.
  • Enhanced Mitochondrial Function and Energy Efficiency:
    S​еmаglutіdе improves mitochondrial biogenesis and respiratory efficiency in adipose and muscle tissue. By increasing energy expenditure and cellular respiration, it supports studies focused on energy optimization, endurance, and longevity in metabolic research.
  • Synergistic Potential with Other Metabolic Peptides:
    Research often explores the combination of S​еmаglutіdе with Cagrilintide, AOD-9604, or T​іrzеpаtіdе to enhance fat oxidation, appetite control, and glucose homeostasis. These synergistic interactions expand its application in advanced metabolic and body composition research models.
  • Long-Term Metabolic Adaptation and Weight Maintenance:
    Extended follow-up studies show that S​еmаglutіdе users maintain most of their weight reduction even after discontinuation, indicating durable metabolic reprogramming. This sustained adaptation supports its investigation in long-term studies of energy regulation, obesity relapse prevention, and metabolic health restoration.

Research Data​

Study/modelReported effect
Human RCTs (Type 2 Diabetes)

↓ HbA1c up to -1.8%, ↓ body weight 5-10% vs placebo

Human RCTs (Obesity)

↓ Body weight up to 15% after 68 weeks, ↓ waist circumference

Comparative trials (S​еmаglutіdе vs Liraglutide)

Greater body weight reduction and metabolic improvements

Rodent models of obesity

↓ Food intake, ↑ thermogenesis and lipid oxidation

In vitro β-cell studies

↑ Insulin secretion and β-cell proliferation via GLP-1R

Nonalcoholic fatty liver models

↓ Hepatic fat content and inflammatory cytokines

Human post-hoc analyses

↓ LDL, ↓ CRP, improved cardiovascular biomarkers

Stack Suggestions​

S​еmаglutіdе is commonly stacked with Cagrilintide to explore synergistic appetite suppression.

It may also be combined with AOD-9604 in metabolic studies focused on adipose tissue regulation.

Stacks discussed are for experimental design only, not safety or efficacy guidance.

Pen Dosage Chart​

S​еmаglutіdе Pen 5 mg
Volume2.0 mL
mg/mL2.5 mg/mL
Click-to-Dose1 click = 0.025 mg
Example(s)10 clicks = 0.25 mg; 40 clicks = 1.0 mg

Dosage & Protocols Variations​

Standard Metabolic Protocol

  • Dose: 0.25 – 1 mg (= 10–40 clicks)
  • Duration: 8 – 12 weeks
  • Frequency: 1× weekly
  • Cycle Interval: 8-week rest
  • Goal / Description: Designed for glucose and metabolic balance studies

Weight Management Protocol

  • Dose: 0.5 – 2 mg (= 20–80 clicks)
  • Duration: 12 – 24 weeks
  • Frequency: 1× weekly
  • Cycle Interval: 8-week rest
  • Goal / Description: Used in obesity and appetite regulation models

Comparative GLP-1 Study

  • Dose: 1 mg (= 40 clicks)
  • Duration: 8 – 12 weeks
  • Frequency: 1× weekly
  • Cycle Interval: 8-week rest
  • Goal / Description: Comparative analysis with GLP-1/GIP dual agonists

Maintenance Protocol

  • Dose: 0.25 – 0.5 mg (= 10–20 clicks)
  • Duration: ongoing
  • Frequency: 1× weekly
  • Cycle Interval: 12-week rest
  • Goal / Description: Sustains experimental adaptation phase outcomes

Possible Side Effects​

S​еmаglutіdе, as a research peptide, may induce side effects in experimental models, primarily affecting the gastrointestinal system due to its impact on motility and secretion. These reactions are often dose-dependent and more prominent during initial titration phases via subcutaneous administration. Monitoring is key to assess tolerance.

Nausea: The most frequent issue, manifesting as mild to moderate queasiness post-injection, which typically subsides with continued use.
Vomiting: Occurs in some models, especially at higher doses, linked to delayed gastric emptying.
Diarrhea: Loose stools may arise from altered intestinal transit, sometimes accompanied by abdominal discomfort.
Constipation: Conversely, slowed motility can lead to infrequent bowel movements in certain cases.
Fatigue: General tiredness or lethargy, possibly from caloric restriction or metabolic shifts.
Headache: Mild headaches reported, potentially from dehydration or blood sugar changes.

It is important to note that most side effects are transient and manageable with dose adjustments. Rare but serious concerns include pancreatitis or gallbladder issues, emphasizing the need for careful observation in protocols.

Product Attributes​

  • CAS #: 910463-68-2
  • Molecular Formula: C187H291N45O59
  • Sequence (AA): HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG -amide (modified)
  • Molecular Weight: 4113.58 g/mol
  • PubChem CID: 56843331
  • Half-Life: ~7 days
  • Synonyms: Ozempic, Wegovy, GLP-1 Analog, Rybelsus, NN9535
  • Type: Synthetic Analog (GHRH Analog) + Synthetic Peptide (GHRP)
  • Research Focus: Recovery & Performance, Metabolism, Anti-Aging

Scientific References​

Included In The Box

Every product arrives in a premium, custom-designed PEPTIDE.Power box, engineered for convenience, hygiene, and safe storage in your refrigerator. Inside, you will find everything needed for your full research protocol:

  • 1× Disposable Pre-Mixed Injection Pen
  • Powered by our proprietary PSM Technology™ – precision stabilization & mixing system for consistent potency
  • 10× Ultra-thin Needles (33G, 4 mm)
  • 10× Alcohol Pads for sterile preparation
  • Internal Stabilizing Foam Insert to prevent shaking during transport
  • Instruction Panel printed on the inside of the box for quick reference
  • Security Seal Sticker ensuring the package has not been opened or tampered with

Store the product in a refrigerator at 1 – 8°C immediately upon delivery. To maintain optimal stability, keep the pen away from light, and do not expose it to repeated temperature changes.

Once reconstituted (all our pens come pre-mixed), research compounds remain stable for 6 – 8 weeks under proper refrigeration.

Do not freeze after reconstitution. Always keep the box closed so the pen, needles, and alcohol pads stay clean and protected.

For best results, use the product consistently within the recommended time window and always follow your research protocol.

We ship with Next-Day EU Delivery via DHL Express or UPS Express.

All orders are prepared fresh on the day of dispatch, placed in EPS Cold-Chain Transport Boxes, and shipped with cooling elements to maintain a stable temperature throughout the journey.

Our logistics process is designed so the package arrives overnight, avoiding customs delays inside the European Union.

Products are shipped from our EU facility, ensuring no import duties, no customs clearance, and always fast and secure delivery.

Due to the nature of research peptides and the high-risk category assigned by payment processors, credit card companies do not generally support merchants in this field.

For this reason, we accept mainly Bank Transfers.

We also work with a crypto payment provider, and from time to time, card payments may be available depending on processor availability.

Within the European Union, SEPA transfers are fast, low-cost, and usually arrive within minutes to a few hours, making the payment process smooth and simple.

Once the transfer is received, your order is prepared immediately and dispatched the same day, depending on the daily cut-off time.

Please note that we do not dispatch shipments on Fridays or on days before official public holidays. This is done to ensure that parcels can be delivered on the next working day and are not held in transit over weekends or holidays.

This method ensures compliance, security, and continuity of service for all customers across the EU.

Didn't find the answer to your question?

View all frequently asked questions

RELATED PRODUCTS