GHRP-6
GHRP-6 Price range: 39,00 € through 66,00 €
Back to products
Ipamorelin
Ipamorelin 51,00 €

IGF-1LR3

IGF-1 LR3 is a long-acting analog of insulin-like growth factor 1 studied for its role in muscle growth, cellular repair, and anabolic signaling. Structural modifications extend its half-life and reduce binding to IGF-binding proteins, allowing prolonged receptor interaction. In research settings, IGF-1 LR3 has been observed to support protein synthesis pathways, cellular proliferation, and recovery-related signaling. Formulated in a stabilized pre-mixed injection pen for research use only.

84,00 €

Quality Certificates

Independent third-party lab analysis (CoA) - from our own in-house brand.

IGF-1 LR3 - Advanced Anabolic Signaling & Muscle Growth

Muscle Growth Signaling

Activates anabolic IGF pathways

Extended Activity

Longer half-life than native IGF-1

Protein Synthesis Support

Engages mTOR-related signaling

Recovery Research Target

Studied in tissue repair models

Anabolic Pathway Activation

Direct IGF receptor stimulation

Cellular Growth Support

Influences proliferation pathways

Reduced Binding Protein Interference

Increased bioavailability profile

Satellite Cell Activation

Supports muscle precursor cell signaling

Description

IGF-1 LR3 is a modified analog of insulin-like growth factor 1 engineered with an extended amino acid sequence and reduced affinity for IGF-binding proteins. These structural modifications prolong its biological activity compared to native IGF-1. IGF-1 plays a central role in muscle development, cellular growth, and metabolic signaling.

Our formulation is provided in a stabilized pre-mixed injection pen for SubQ administration. Subcutaneous delivery supports controlled systemic exposure and extended receptor engagement in experimental protocols. Each unit is freshly prepared to preserve peptide integrity and standardized dosing. The product is intended strictly for laboratory and research use only.

In preclinical and exploratory human research, IGF-1 LR3 has been studied for its effects on muscle hypertrophy signaling, glucose metabolism pathways, and tissue regeneration processes. By directly activating IGF-1 receptors, it influences downstream anabolic cascades involved in protein synthesis and cellular growth.

Clinical Status

Human RCT ▣ | Observational ▣ | Animal ✔ | In vitro ✔

Primarily studied in preclinical anabolic and metabolic research contexts, with limited exploratory human data.

Mechanism of Action​

IGF-1 LR3 directly activates IGF-1 receptors, stimulating pathways involved in muscle growth and cellular repair. Its extended half-life allows prolonged receptor interaction compared to native IGF-1. This activation supports anabolic signaling and protein synthesis in experimental models.

Benefits

  • Direct activation of the IGF-1 receptor for anabolic signaling:
    IGF-1 LR3 binds directly to the IGF-1 receptor expressed on muscle and other peripheral tissues. This receptor functions as a tyrosine kinase that initiates intracellular growth cascades once activated. Unlike growth hormone secretagogues that rely on stimulating the pituitary first, IGF-1 LR3 works downstream at the tissue level. This direct engagement creates a more immediate anabolic signaling response in experimental models. Activation of this receptor influences pathways associated with protein synthesis, cell survival, and structural adaptation. Because the signal originates at the receptor level, it bypasses hypothalamic and pituitary regulatory layers.
  • Extended half-life and prolonged receptor engagement:
    One of the defining features of IGF-1 LR3 is its structural modification that reduces binding to IGF-binding proteins. In native form, IGF-1 is tightly regulated by these proteins, limiting free circulating activity. The LR3 modification allows more unbound peptide to remain biologically active. This increases duration of receptor interaction and sustains anabolic signaling over a longer period. In research settings, this extended engagement is associated with prolonged intracellular activation compared to native IGF-1.
  • Stimulation of the PI3K/Akt/mTOR protein synthesis pathway:
    Upon receptor activation, IGF-1 LR3 triggers intracellular cascades including PI3K and Akt phosphorylation. These signals converge on mTOR, a master regulator of protein translation and cellular growth. mTOR activation increases ribosomal activity and enhances structural protein assembly within muscle fibers. This cascade is central to hypertrophy-related research. Because the pathway operates inside the cell, it influences structural remodeling rather than superficial fluid retention or transient effects.
  • Promotion of muscle cell differentiation and satellite cell support:
    IGF signaling is involved in the activation and differentiation of satellite cells, which are precursor cells responsible for muscle regeneration. In laboratory models, IGF-1 pathway stimulation increases expression of myogenic regulatory factors. These factors coordinate transformation of precursor cells into mature contractile fibers. This cellular process contributes to structural muscle adaptation in controlled experimental settings.
  • Influence on cellular survival and anti-apoptotic signaling:
    Beyond muscle growth, IGF-1 receptor activation influences survival pathways within cells. Akt signaling promotes anti-apoptotic mechanisms that help protect cells under stress conditions. This dimension extends IGF-1 LR3 relevance beyond hypertrophy into broader tissue resilience research. By supporting cellular survival cascades, it contributes to regenerative signaling environments in experimental models.
  • Metabolic signaling integration:
    IGF-1 shares structural similarity with insulin and interacts with metabolic signaling networks. Activation of IGF pathways influences glucose uptake, nutrient utilization, and energy partitioning at the cellular level. These effects connect anabolic signaling with metabolic regulation. In research contexts, this integration allows exploration of how growth signaling and nutrient handling intersect.
  • Bypasses upstream endocrine stimulation:
    Unlike peptides that stimulate growth hormone release, IGF-1 LR3 does not depend on pituitary activation. It directly engages peripheral receptors without first altering hypothalamic pulses. This distinction makes it relevant in research focused specifically on downstream anabolic mechanisms rather than upstream endocrine control. The absence of pituitary stimulation changes its signaling profile compared to GH secretagogues.
  • Sustained intracellular growth signaling environment:
    Because of its extended activity and direct receptor binding, IGF-1 LR3 creates a more persistent intracellular growth signal in experimental systems. Sustained activation of Akt and MAPK pathways contributes to ongoing protein synthesis and cellular adaptation. This prolonged intracellular environment differentiates it from shorter-acting IGF variants.
  • Designed for structured anabolic research use:
    Provided in a stabilized pre-mixed injection pen for SubQ administration, IGF-1 LR3 supports predictable systemic exposure in controlled research protocols. Subcutaneous delivery allows structured dosing and reproducible receptor engagement assessment. Each unit is freshly prepared and intended strictly for laboratory use only.

Research Data​

Study / ModelReported effect
Rodent skeletal muscle model↑ myofiber hypertrophy and protein synthesis via IGF-1R activation
In vitro myoblast culture↑ proliferation and differentiation; enhanced Akt/mTOR signaling
Pharmacokinetic comparison vs native IGF-1Extended half-life and reduced IGFBP binding affinity
Cellular repair models↑ satellite cell activation and tissue regeneration markers
Glucose metabolism studies↑ peripheral glucose uptake; modulated insulin sensitivity
Anabolic signaling assaysSustained receptor phosphorylation and downstream PI3K activation

Stack Suggestions​

IGF-1 LR3 is often combined in research with:

  • IGF-1 LR3 + CJC-1295 → Amplifies GH/IGF-1 axis activity for enhanced anabolic signaling.
  • IGF-1 LR3 + Ipamorelin → Combines direct IGF-1 receptor activation with pulsatile GH release.
  • IGF-1 LR3 + BPC-157 → Supports tissue repair and recovery alongside anabolic growth signaling.
  • IGF-1 LR3 + TB-500 → Synergistic muscle regeneration and structural remodeling in injury models.

⚠ Stacks are for experimental design only; not safety or efficacy guidance.

Pen Dosage Chart​

IGF-1LR3 Pen 1 mg
Volume1 mL
mg/mL1 mg/mL
Click-to-Dose1 click = 0.01 mg
Example(s)10 clicks = 0.1 mg

Dosage & Protocols Variations​

Standard Research Protocol

  • Dose: 0.02 – 0.05 mg (= 2-5 clicks)
  • Duration: 4 – 6 weeks
  • Frequency: Daily
  • Cycle Interval: 4 weeks off before repeating
  • Goal / Description: Baseline anabolic signaling and muscle growth models.

Therapeutic Research Protocol

  • Dose: 0.05 – 0.1 mg (= 5-10 clicks)
  • Duration: 4 weeks
  • Frequency: Daily, post-training in targeted muscle groups
  • Cycle Interval: 4 – 6 weeks off before repeating
  • Goal / Description: Higher-dose protocol for hypertrophy and cellular repair studies.

Stacked Protocol (IGF-1 LR3 + CJC-1295/Ipamorelin)

  • Dose: 0.02 – 0.04 mg IGF-1 LR3 (= 2-4 clicks)
  • Duration: 4 – 6 weeks
  • Frequency: Daily
  • Cycle Interval: 4 weeks off before repeating
  • Goal / Description: Combined GH and IGF-1 axis stimulation for anabolic research.

Possible Side Effects​

IGF-1 LR3 is generally tolerated in research models, but several effects have been reported in experimental and observational data:

  • Hypoglycemia due to insulin-like activity on glucose uptake.
  • Localized swelling, redness, or discomfort at injection site.
  • Transient headaches or lightheadedness during initial dosing.
  • Joint pain or muscle cramps in prolonged research protocols.
  • Potential organ enlargement with extended high-dose exposure in animal models.

No evidence of acute toxicity has been observed at standard research doses, though long-term effects on cellular proliferation remain under investigation.

Product Attributes​

  • CAS #: 946870-92-4
  • Molecular Formula: C400H625N111O115S9
  • Sequence (AA): MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
  • Molecular Weight: ~9117.6 g/mol
  • Half-Life: ~20-30 hours
  • Synonyms: Long R3 IGF-1, LR3 IGF-1, Insulin-like Growth Factor 1 Long R3
  • Type: Synthetic research peptide (IGF-1 analog)
  • Research Focus: Recovery & Performance, Muscle Growth & Anabolic Signaling

Scientific References​

Included In The Box

Every product arrives in a premium, custom-designed PEPTIDE.Power box, engineered for convenience, hygiene, and safe storage in your refrigerator. Inside, you will find everything needed for your full research protocol:

  • 1× Disposable Pre-Mixed Injection Pen
  • Powered by our proprietary PSM Technology™: precision stabilization & mixing system for consistent potency
  • 10× Ultra-thin Needles (33G, 4 mm)
  • 10× Alcohol Pads for sterile preparation
  • Internal Stabilizing Foam Insert to prevent shaking during transport
  • Instruction Panel printed on the inside of the box for quick reference
  • Security Seal Sticker ensuring the package has not been opened or tampered with

Store the product in a refrigerator at 1-8°C immediately upon delivery. To maintain optimal stability, keep the pen away from light, and do not expose it to repeated temperature changes.

Once reconstituted (all our pens come pre-mixed), research compounds remain stable for 6-8 weeks under proper refrigeration.

Do not freeze after reconstitution. Always keep the box closed so the pen, needles, and alcohol pads stay clean and protected.

For best results, use the product consistently within the recommended time window and always follow your research protocol.

We ship with Next-Day EU Delivery via DHL Express or UPS Express.

All orders are prepared fresh on the day of dispatch, placed in EPS Cold-Chain Transport Boxes, and shipped with cooling elements to maintain a stable temperature throughout the journey.

Our logistics process is designed so the package arrives overnight, avoiding customs delays inside the European Union.

Products are shipped from our EU facility, ensuring no import duties, no customs clearance, and always fast and secure delivery.

Due to the nature of research peptides and the high-risk category assigned by payment processors, credit card companies do not generally support merchants in this field.

For this reason, we accept mainly Bank Transfers.

We also work with a crypto payment provider, and from time to time, card payments may be available depending on processor availability.

Within the European Union, SEPA transfers are fast, low-cost, and usually arrive within minutes to a few hours, making the payment process smooth and simple.

Once the transfer is received, your order is prepared immediately and dispatched the same day, depending on the daily cut-off time.

Please note that we do not dispatch shipments on Fridays or on days before official public holidays. This is done to ensure that parcels can be delivered on the next working day and are not held in transit over weekends or holidays.

This method ensures compliance, security, and continuity of service for all customers across the EU.

Didn't find the answer to your question?

View all frequently asked questions

RELATED PRODUCTS